Lineage for d2co0a_ (2co0 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1554832Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 1554967Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 1554968Protein automated matches [190568] (4 species)
    not a true protein
  7. 1554969Species Human (Homo sapiens) [TaxId:9606] [187559] (36 PDB entries)
  8. 1555010Domain d2co0a_: 2co0 A: [163459]
    automated match to d1vyhc1

Details for d2co0a_

PDB Entry: 2co0 (more details), 2.25 Å

PDB Description: wdr5 and unmodified histone h3 complex at 2.25 angstrom
PDB Compounds: (A:) wd-repeat protein 5

SCOPe Domain Sequences for d2co0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2co0a_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalmftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgmclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldndlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednmvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

SCOPe Domain Coordinates for d2co0a_:

Click to download the PDB-style file with coordinates for d2co0a_.
(The format of our PDB-style files is described here.)

Timeline for d2co0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2co0c_