Lineage for d2cgfa_ (2cgf A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667396Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1667572Protein automated matches [190229] (8 species)
    not a true protein
  7. 1667573Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187543] (7 PDB entries)
  8. 1667579Domain d2cgfa_: 2cgf A: [163400]
    automated match to d1a4ha_
    complexed with p2n

Details for d2cgfa_

PDB Entry: 2cgf (more details), 2.2 Å

PDB Description: a radicicol analogue bound to the atp binding site of the n-terminal domain of the yeast hsp90 chaperone
PDB Compounds: (A:) ATP-dependent molecular chaperone hsp82

SCOPe Domain Sequences for d2cgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cgfa_ d.122.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
asetfefqaeitqlmsliintvysnkeiflrelisnasdaldkirykslsdpkqletepd
lfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqfg
vgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkddq
leyleekrikevikkhsefvaypiqlvvtkev

SCOPe Domain Coordinates for d2cgfa_:

Click to download the PDB-style file with coordinates for d2cgfa_.
(The format of our PDB-style files is described here.)

Timeline for d2cgfa_: