SCOPe 2.08: Domain d2cgfa1: 2cgf A:4-213

Lineage for d2cgfa1 (2cgf A:4-213)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187543] (7 PDB entries)

8. Domain d2cgfa1: 2cgf A:4-213 [163400]
   Other proteins in same PDB: d2cgfa2
   automated match to d1a4ha_
   complexed with p2n

Details for d2cgfa1

PDB Entry: 2cgf, 2.2 Å

PDB Description: a radicicol analogue bound to the atp binding site of the n-terminal domain of the yeast hsp90 chaperone

PDB Compounds: (A:) ATP-dependent molecular chaperone hsp82

SCOPe Domain Sequences for d2cgfa1:

Sequence; same for both SEQRES and ATOM records:

>d2cgfa1 d.122.1.1 (A:4-213) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
etfefqaeitqlmsliintvysnkeiflrelisnasdaldkirykslsdpkqletepdlf
iritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqfgvg
fyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkddqle
yleekrikevikkhsefvaypiqlvvtkev

Timeline for d2cgfa1:

• d2cgfa1 first appeared in SCOPe 2.01, called d2cgfa_
  
• d2cgfa1 appears in SCOPe 2.07