SCOPe 2.08: Domain d2ce2x_: 2ce2 X:

Lineage for d2ce2x_ (2ce2 X:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2ce2x_: 2ce2 X: [163378]
   automated match to d1aa9a_
   complexed with gdp, mg, xy2

Details for d2ce2x_

PDB Entry: 2ce2, 1 Å

PDB Description: crystal structure analysis of a fluorescent form of h-ras p21 in complex with gdp

PDB Compounds: (X:) gtpase hras

SCOPe Domain Sequences for d2ce2x_:

Sequence; same for both SEQRES and ATOM records:

>d2ce2x_ c.37.1.8 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d2ce2x_:

• d2ce2x_ first appeared in SCOPe 2.01
  
• d2ce2x_ appears in SCOPe 2.07