SCOPe 2.02: Domain d2cb8a_: 2cb8 A:

Lineage for d2cb8a_ (2cb8 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families)

5. Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)

6. Protein automated matches [190551] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187531] (3 PDB entries)

8. Domain d2cb8a_: 2cb8 A: [163356]
   automated match to d1acaa_
   complexed with mxe, mya, so4, zn

Details for d2cb8a_

PDB Entry: 2cb8, 1.4 Å

PDB Description: high resolution crystal structure of liganded human l-acbp

PDB Compounds: (A:) acyl-coa-binding protein

SCOPe Domain Sequences for d2cb8a_:

Sequence; same for both SEQRES and ATOM records:

>d2cb8a_ a.11.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqaefekaaeevrhlktkpsdeemlfiyghykqatvgdinterpgmldftgkakwdawne
lkgtskedamkayinkveelkkkygi

Timeline for d2cb8a_:

• d2cb8a_ first appeared in SCOPe 2.01
  
• d2cb8a_ appears in SCOPe 2.03
  
• d2cb8a_ appears in the current release, SCOPe 2.08