| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) ![]() |
| Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins) automatically mapped to Pfam PF00887 |
| Protein automated matches [190551] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187531] (3 PDB entries) |
| Domain d2cb8a_: 2cb8 A: [163356] automated match to d1acaa_ complexed with mxe, mya, so4, zn |
PDB Entry: 2cb8 (more details), 1.4 Å
SCOPe Domain Sequences for d2cb8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cb8a_ a.11.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqaefekaaeevrhlktkpsdeemlfiyghykqatvgdinterpgmldftgkakwdawne
lkgtskedamkayinkveelkkkygi
Timeline for d2cb8a_: