SCOPe 2.04: Domain d2c49b_: 2c49 B:

Lineage for d2c49b_ (2c49 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (35 species)
   not a true protein

7. Species Methanococcus jannaschii [TaxId:2190] [187510] (2 PDB entries)

8. Domain d2c49b_: 2c49 B: [163257]
   automated match to d1vm7b_
   complexed with adn, anp, mg

Details for d2c49b_

PDB Entry: 2c49, 1.92 Å

PDB Description: crystal structure of methanocaldococcus jannaschii nucleoside kinase - an archaeal member of the ribokinase family

PDB Compounds: (B:) sugar kinase mj0406

SCOPe Domain Sequences for d2c49b_:

Sequence; same for both SEQRES and ATOM records:

>d2c49b_ c.72.1.0 (B:) automated matches {Methanococcus jannaschii [TaxId: 2190]}
gkmekitcvghtaldyifnvekfpepntsiqipsarkyyggaaantavgikklgvnsell
scvgydfknsgyerylknldinisklyyseeeetpkawiftdkdnnqitfflwgaakhyk
elnppnfnteivhiatgdpefnlkcakkaygnnlvsfdpgqdlpqyskemlleiiehtnf
lfmnkheferasnllnfeiddylervdalivtkgskgsviytkdkkieipcikagkvidp
tgagdsyragflsayvkgydlekcgligaatasfvveakgcqtnlptwdkvverlekh

Timeline for d2c49b_:

• d2c49b_ first appeared in SCOPe 2.01
  
• d2c49b_ appears in SCOPe 2.03
  
• d2c49b_ appears in SCOPe 2.05
  
• d2c49b_ appears in the current release, SCOPe 2.08