Lineage for d2c49b_ (2c49 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385058Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1385059Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1385284Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1385285Protein automated matches [190117] (34 species)
    not a true protein
  7. 1385381Species Methanococcus jannaschii [TaxId:2190] [187510] (2 PDB entries)
  8. 1385384Domain d2c49b_: 2c49 B: [163257]
    automated match to d1vm7b_
    complexed with adn, anp, mg

Details for d2c49b_

PDB Entry: 2c49 (more details), 1.92 Å

PDB Description: crystal structure of methanocaldococcus jannaschii nucleoside kinase - an archaeal member of the ribokinase family
PDB Compounds: (B:) sugar kinase mj0406

SCOPe Domain Sequences for d2c49b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c49b_ c.72.1.0 (B:) automated matches {Methanococcus jannaschii [TaxId: 2190]}
gkmekitcvghtaldyifnvekfpepntsiqipsarkyyggaaantavgikklgvnsell
scvgydfknsgyerylknldinisklyyseeeetpkawiftdkdnnqitfflwgaakhyk
elnppnfnteivhiatgdpefnlkcakkaygnnlvsfdpgqdlpqyskemlleiiehtnf
lfmnkheferasnllnfeiddylervdalivtkgskgsviytkdkkieipcikagkvidp
tgagdsyragflsayvkgydlekcgligaatasfvveakgcqtnlptwdkvverlekh

SCOPe Domain Coordinates for d2c49b_:

Click to download the PDB-style file with coordinates for d2c49b_.
(The format of our PDB-style files is described here.)

Timeline for d2c49b_: