Lineage for d1chua1 (1chu A:423-533)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45997Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 46031Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase C-terminal domain [46977] (1 family) (S)
  5. 46032Family a.7.3.1: Succinate dehydrogenase/fumarate reductase C-terminal domain [46978] (2 proteins)
  6. 46046Protein L-aspartate oxidase [46979] (1 species)
  7. 46047Species Escherichia coli [TaxId:562] [46980] (1 PDB entry)
  8. 46048Domain d1chua1: 1chu A:423-533 [16325]
    Other proteins in same PDB: d1chua2, d1chua3

Details for d1chua1

PDB Entry: 1chu (more details), 2.2 Å

PDB Description: structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family

SCOP Domain Sequences for d1chua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli}
desrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyahfr
vsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp

SCOP Domain Coordinates for d1chua1:

Click to download the PDB-style file with coordinates for d1chua1.
(The format of our PDB-style files is described here.)

Timeline for d1chua1: