Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) |
Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins) |
Protein L-aspartate oxidase [46979] (1 species) |
Species Escherichia coli [TaxId:562] [46980] (3 PDB entries) |
Domain d1chua1: 1chu A:423-533 [16325] Other proteins in same PDB: d1chua2, d1chua3 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1chu (more details), 2.2 Å
SCOPe Domain Sequences for d1chua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli [TaxId: 562]} desrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyahfr vsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp
Timeline for d1chua1: