Lineage for d1chua3 (1chu A:238-353)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85568Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 85569Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 85570Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (3 proteins)
  6. 85597Protein L-aspartate oxidase [56427] (1 species)
  7. 85598Species Escherichia coli [TaxId:562] [56428] (1 PDB entry)
  8. 85599Domain d1chua3: 1chu A:238-353 [42307]
    Other proteins in same PDB: d1chua1, d1chua2

Details for d1chua3

PDB Entry: 1chu (more details), 2.2 Å

PDB Description: structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family

SCOP Domain Sequences for d1chua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chua3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli}
lefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivarai
dhemkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahyt

SCOP Domain Coordinates for d1chua3:

Click to download the PDB-style file with coordinates for d1chua3.
(The format of our PDB-style files is described here.)

Timeline for d1chua3: