SCOPe 2.02: Domain d2bw7c_: 2bw7 C:

Lineage for d2bw7c_ (2bw7 C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein automated matches [190310] (1 species)
   not a true protein

7. Species Spirulina platensis [TaxId:118562] [187494] (1 PDB entry)

8. Domain d2bw7c_: 2bw7 C: [163192]
   automated match to d1wc4a_
   complexed with apc, ca, ecs, mg

Details for d2bw7c_

PDB Entry: 2bw7, 2.3 Å

PDB Description: a novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen

PDB Compounds: (C:) adenylate cyclase

SCOPe Domain Sequences for d2bw7c_:

Sequence; same for both SEQRES and ATOM records:

>d2bw7c_ d.58.29.1 (C:) automated matches {Spirulina platensis [TaxId: 118562]}
mrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqg
mavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflel
kgidepvmtcvinpnm

Timeline for d2bw7c_:

• d2bw7c_ first appeared in SCOPe 2.01
  
• d2bw7c_ appears in SCOPe 2.03
  
• d2bw7c_ appears in the current release, SCOPe 2.08, called d2bw7c1