Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
Protein automated matches [190310] (1 species) not a true protein |
Species Spirulina platensis [TaxId:118562] [187494] (1 PDB entry) |
Domain d2bw7a_: 2bw7 A: [163190] automated match to d1wc4a_ complexed with apc, ca, ecs, mg |
PDB Entry: 2bw7 (more details), 2.3 Å
SCOPe Domain Sequences for d2bw7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bw7a_ d.58.29.1 (A:) automated matches {Spirulina platensis [TaxId: 118562]} shmrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgd aimalygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgih qgmavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikrefl elkgidepvmtcvinpnm
Timeline for d2bw7a_: