Lineage for d2bv7a_ (2bv7 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1102223Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 1102224Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 1102225Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)
  6. 1102240Protein automated matches [190530] (2 species)
    not a true protein
  7. 1102241Species Cow (Bos taurus) [TaxId:9913] [187491] (2 PDB entries)
  8. 1102243Domain d2bv7a_: 2bv7 A: [163171]
    automated match to d1sx6a_
    complexed with gm3, so4

Details for d2bv7a_

PDB Entry: 2bv7 (more details), 1.79 Å

PDB Description: crystal structure of gltp with bound gm3
PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d2bv7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv7a_ a.224.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
llrplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnptkf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekvrlflvny
tatidviyemytrmnaelnykv

SCOPe Domain Coordinates for d2bv7a_:

Click to download the PDB-style file with coordinates for d2bv7a_.
(The format of our PDB-style files is described here.)

Timeline for d2bv7a_: