Class a: All alpha proteins [46456] (284 folds) |
Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily) multihelical; 2 layers or orthogonally packed helices |
Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) |
Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins) |
Protein automated matches [190530] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187491] (2 PDB entries) |
Domain d2bv7a_: 2bv7 A: [163171] automated match to d1sx6a_ complexed with gm3, so4 |
PDB Entry: 2bv7 (more details), 1.79 Å
SCOPe Domain Sequences for d2bv7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bv7a_ a.224.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} llrplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnptkf rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekvrlflvny tatidviyemytrmnaelnykv
Timeline for d2bv7a_: