Lineage for d2boib_ (2boi B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430565Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2430566Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2430714Family b.115.1.0: automated matches [191398] (1 protein)
    not a true family
  6. 2430715Protein automated matches [190521] (2 species)
    not a true protein
  7. 2430734Species Chromobacterium violaceum [TaxId:536] [187479] (2 PDB entries)
  8. 2430738Domain d2boib_: 2boi B: [163136]
    automated match to d1uqxa_
    complexed with ca, mfu

Details for d2boib_

PDB Entry: 2boi (more details), 1.1 Å

PDB Description: 1.1a structure of chromobacterium violaceum lectin cv2l in complex with alpha-methyl-fucoside
PDB Compounds: (B:) cv-iil lectin

SCOPe Domain Sequences for d2boib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2boib_ b.115.1.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 536]}
aqqgvftlparinfgvtvlvnsaatqhveifvdnepraafsgvgtgdnnlgtkvinsgsg
nvrvqitangrqsdlvssqlvlanklnlavvgsedgtdmdyndsivilnwplg

SCOPe Domain Coordinates for d2boib_:

Click to download the PDB-style file with coordinates for d2boib_.
(The format of our PDB-style files is described here.)

Timeline for d2boib_: