SCOP 1.67: Domain d1exia1: 1exi A:3-120

Lineage for d1exia1 (1exi A:3-120)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families)

5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (4 proteins)
   includes a dimerisation, antiparallel coiled-coil subdomain

6. Protein Transcription activator BmrR [46963] (1 species)
   followed by long alpha-helical linker

7. Species Bacillus subtilis [TaxId:1423] [46964] (2 PDB entries)

8. Domain d1exia1: 1exi A:3-120 [16310]
   Other proteins in same PDB: d1exia2
   protein/DNA complex; complexed with 118, zn

Details for d1exia1

PDB Entry: 1exi, 3.12 Å

PDB Description: crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpsb

SCOP Domain Sequences for d1exia1:

Sequence; same for both SEQRES and ATOM records:

>d1exia1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

Timeline for d1exia1:

• d1exia1 first appeared (with stable ids) in SCOP 1.55
  
• d1exia1 appears in SCOP 1.65
  
• d1exia1 appears in SCOP 1.69
  
• d1exia1 appears in the current release, SCOPe 2.08