![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
![]() | Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins) includes a dimerisation, antiparallel coiled-coil subdomain |
![]() | Protein Transcription activator BmrR [46963] (1 species) followed by long alpha-helical linker |
![]() | Species Bacillus subtilis [TaxId:1423] [46964] (4 PDB entries) Uniprot P39075 |
![]() | Domain d1exia1: 1exi A:3-120 [16310] Other proteins in same PDB: d1exia2 protein/DNA complex; complexed with 118, zn |
PDB Entry: 1exi (more details), 3.12 Å
SCOPe Domain Sequences for d1exia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exia1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]} esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa
Timeline for d1exia1: