SCOPe 2.06: Domain d1exja1: 1exj A:3-120

Lineage for d1exja1 (1exj A:3-120)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
   includes a dimerisation, antiparallel coiled-coil subdomain

6. Protein Transcription activator BmrR [46963] (1 species)
   followed by long alpha-helical linker

7. Species Bacillus subtilis [TaxId:1423] [46964] (4 PDB entries)
   Uniprot P39075

8. Domain d1exja1: 1exj A:3-120 [16309]
   Other proteins in same PDB: d1exja2
   protein/DNA complex; complexed with na, p4p, zn

Details for d1exja1

PDB Entry: 1exj, 3 Å

PDB Description: crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpp

PDB Compounds: (A:) multidrug-efflux transporter regulator

SCOPe Domain Sequences for d1exja1:

Sequence; same for both SEQRES and ATOM records:

>d1exja1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

Timeline for d1exja1:

• d1exja1 first appeared (with stable ids) in SCOP 1.55
  
• d1exja1 appears in SCOPe 2.05
  
• d1exja1 appears in SCOPe 2.07
  
• d1exja1 appears in the current release, SCOPe 2.08