![]() | Class a: All alpha proteins [46456] (138 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) ![]() |
![]() | Family a.6.1.3: DNA-binding domain of transcription activator BmrR [46962] (1 protein) |
![]() | Protein DNA-binding domain of transcription activator BmrR [46963] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [46964] (2 PDB entries) |
![]() | Domain d1exja1: 1exj A:3-120 [16309] Other proteins in same PDB: d1exja2 |
PDB Entry: 1exj (more details), 3 Å
SCOP Domain Sequences for d1exja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exja1 a.6.1.3 (A:3-120) DNA-binding domain of transcription activator BmrR {Bacillus subtilis} esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa
Timeline for d1exja1: