SCOPe 2.04: Domain d2b2db_: 2b2d B:

Lineage for d2b2db_ (2b2d B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein automated matches [190495] (3 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:12022] [187438] (2 PDB entries)

8. Domain d2b2db_: 2b2d B: [162974]
   automated match to d1u1ya_
   protein/RNA complex; mutant

Details for d2b2db_

PDB Entry: 2b2d, 2.9 Å

PDB Description: rna stemloop operator from bacteriophage qbeta complexed with an n87s, e89k mutant ms2 capsid

PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d2b2db_:

Sequence; same for both SEQRES and ATOM records:

>d2b2db_ d.85.1.1 (B:) automated matches {Enterobacteria phage [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylsmkltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d2b2db_:

• d2b2db_ first appeared in SCOPe 2.01
  
• d2b2db_ appears in SCOPe 2.03
  
• d2b2db_ appears in SCOPe 2.05
  
• d2b2db_ appears in the current release, SCOPe 2.08