| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
| Protein MS2 virus coat protein [55407] (1 species) |
| Species Bacteriophage MS2 [TaxId:12022] [55408] (28 PDB entries) Uniprot P03612 |
| Domain d1u1ya_: 1u1y A: [112965] protein/RNA complex |
PDB Entry: 1u1y (more details), 2.85 Å
SCOPe Domain Sequences for d1u1ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1ya_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
Timeline for d1u1ya_: