PDB entry 1u1y

View 1u1y on RCSB PDB site
Description: Crystal structure of a complex between WT bacteriophage MS2 coat protein and an F5 aptamer RNA stemloop with 2aminopurine substituted at the-10 position
Class: Virus/RNA
Keywords: Complex (Capsid protein-RNA hairpin), Hairpin, Capsid, Levivirus, Icosahedral virus, Virus/RNA COMPLEX
Deposited on 2004-07-16, released 2004-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.188
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1u1ya_
  • Chain 'B':
    Compound: coat protein
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1u1yb_
  • Chain 'C':
    Compound: coat protein
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1u1yc_
  • Chain 'R':
    Compound: 5'-r(*cp*cp*gp*gp*(2pr)p*gp*gp*ap*up*cp*ap*cp*cp*ap*cp*gp*g)-3'
  • Chain 'S':
    Compound: 5'-r(*cp*cp*gp*gp*(2pr)p*gp*gp*ap*up*cp*ap*cp*cp*ap*cp*gp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1yA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1yB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1yC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.