| Class b: All beta proteins [48724] (174 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
| Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
| Protein automated matches [190055] (4 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (6 PDB entries) |
| Domain d2awxa_: 2awx A: [162935] automated match to d1qlca_ complexed with his |
PDB Entry: 2awx (more details), 1.8 Å
SCOPe Domain Sequences for d2awxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awxa_ b.36.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn
svsleevtheeavtalkntsdfvylkvakpts
Timeline for d2awxa_: