SCOPe 2.02: Domain d2awua_: 2awu A:

Lineage for d2awua_ (2awu A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (7 PDB entries)

8. Domain d2awua_: 2awu A: [162931]
   automated match to d1qlca_

Details for d2awua_

PDB Entry: 2awu, 2.44 Å

PDB Description: synapse associated protein 97 pdz2 domain variant c378g

PDB Compounds: (A:) Synapse-associated protein 97

SCOPe Domain Sequences for d2awua_:

Sequence; same for both SEQRES and ATOM records:

>d2awua_ b.36.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavn
svgleevtheeavtalkntsdfvylkvakptsmyi

Timeline for d2awua_:

• d2awua_ first appeared in SCOPe 2.01
  
• d2awua_ appears in SCOPe 2.03
  
• d2awua_ appears in the current release, SCOPe 2.08