SCOPe 2.06: Domain d2at3x_: 2at3 X:

Lineage for d2at3x_ (2at3 X:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Rhodnius prolixus [TaxId:13249] [187425] (3 PDB entries)

8. Domain d2at3x_: 2at3 X: [162893]
   automated match to d1d2ua_
   complexed with hem, imd; mutant

Details for d2at3x_

PDB Entry: 2at3, 1 Å

PDB Description: 1.00 a crystal structure of l123v/l133v mutant of nitrophorin 4 from rhodnius prolixus complexed with imidazole at ph 5.6

PDB Compounds: (X:) Nitrophorin 4

SCOPe Domain Sequences for d2at3x_:

Sequence; same for both SEQRES and ATOM records:

>d2at3x_ b.60.1.1 (X:) automated matches {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tcvhkgnkdlgdvyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

Timeline for d2at3x_:

• d2at3x_ first appeared in SCOPe 2.01
  
• d2at3x_ appears in SCOPe 2.05
  
• d2at3x_ appears in SCOPe 2.07
  
• d2at3x_ appears in the current release, SCOPe 2.08