SCOPe 2.08: Domain d2amqb_: 2amq B:

Lineage for d2amqb_ (2amq B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [187411] (13 PDB entries)

8. Domain d2amqb_: 2amq B: [162833]
   automated match to d1uj1b_

Details for d2amqb_

PDB Entry: 2amq, 2.3 Å

PDB Description: crystal structure of sars_cov mpro in complex with an inhibitor n3

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d2amqb_:

Sequence; same for both SEQRES and ATOM records:

>d2amqb_ b.47.1.4 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sg

Timeline for d2amqb_:

• d2amqb_ first appeared in SCOPe 2.01
  
• d2amqb_ appears in SCOPe 2.07