Lineage for d2ahna_ (2ahn A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387550Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2387551Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2387729Family b.25.1.0: automated matches [191382] (1 protein)
    not a true family
  6. 2387730Protein automated matches [190478] (2 species)
    not a true protein
  7. 2387733Species Prunus avium [TaxId:42229] [187403] (1 PDB entry)
  8. 2387734Domain d2ahna_: 2ahn A: [162813]
    automated match to d1du5a_

Details for d2ahna_

PDB Entry: 2ahn (more details), 1.3 Å

PDB Description: high resolution structure of a cherry allergen pru av 2
PDB Compounds: (A:) Thaumatin-like protein

SCOPe Domain Sequences for d2ahna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahna_ b.25.1.0 (A:) automated matches {Prunus avium [TaxId: 42229]}
atisfknncpymvwpgtltsdqkpqlsttgfelasqasfqldtpvpwngrfwartgcstd
asgkfvcatadcasgqvmcngngaippatlaefnipagggqdfydvslvdgfnlpmsvtp
qggtgdcktascpanvnavcpselqkkgsdgsvvaclsacvkfgtpqycctppqntpetc
pptnyseifhnacpdaysyayddkrgtftcnggpnyaitfcp

SCOPe Domain Coordinates for d2ahna_:

Click to download the PDB-style file with coordinates for d2ahna_.
(The format of our PDB-style files is described here.)

Timeline for d2ahna_: