![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
![]() | Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) ![]() has two smaller insertion domains |
![]() | Family b.25.1.0: automated matches [191382] (1 protein) not a true family |
![]() | Protein automated matches [190478] (3 species) not a true protein |
![]() | Species Prunus avium [TaxId:42229] [187403] (1 PDB entry) |
![]() | Domain d2ahna_: 2ahn A: [162813] automated match to d1du5a_ |
PDB Entry: 2ahn (more details), 1.3 Å
SCOPe Domain Sequences for d2ahna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahna_ b.25.1.0 (A:) automated matches {Prunus avium [TaxId: 42229]} atisfknncpymvwpgtltsdqkpqlsttgfelasqasfqldtpvpwngrfwartgcstd asgkfvcatadcasgqvmcngngaippatlaefnipagggqdfydvslvdgfnlpmsvtp qggtgdcktascpanvnavcpselqkkgsdgsvvaclsacvkfgtpqycctppqntpetc pptnyseifhnacpdaysyayddkrgtftcnggpnyaitfcp
Timeline for d2ahna_: