Lineage for d2aazc_ (2aaz C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216602Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1216603Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 1216604Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1216843Protein automated matches [190469] (7 species)
    not a true protein
  7. 1216851Species Fungus (Filobasidiella neoformans) [TaxId:5207] [187389] (1 PDB entry)
  8. 1216854Domain d2aazc_: 2aaz C: [162733]
    automated match to d1ci7a_
    complexed with cb3, ump

Details for d2aazc_

PDB Entry: 2aaz (more details), 2.08 Å

PDB Description: cryptococcus neoformans thymidylate synthase complexed with substrate and an antifolate
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d2aazc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aazc_ d.117.1.1 (C:) automated matches {Fungus (Filobasidiella neoformans) [TaxId: 5207]}
rsnpdheeyqyldlirriinvgevrpdrtgtgtvalfappsfrfsladntlpllttkrvf
lrgviaellwfvsgctdakmlssqgvgiwdgngskeflekvglghrregdlgpvygfqwr
hfgaeytdadgdykgkgvdqlqrvidtiknnptdrriilsawnpkdlplmalppchmfcq
ffvslppadspgskpklsclmyqrscdlglgvpfniasyallthmialitdtephefilq
mgdahvyrdhveplktqlereprdfpklkwarskeeigdidgfkvedfvvegykpwgkid
mkmsa

SCOPe Domain Coordinates for d2aazc_:

Click to download the PDB-style file with coordinates for d2aazc_.
(The format of our PDB-style files is described here.)

Timeline for d2aazc_: