![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein automated matches [190142] (12 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [187383] (1 PDB entry) |
![]() | Domain d2a8yd_: 2a8y D: [162718] automated match to d1v4nb_ complexed with mta, so4 |
PDB Entry: 2a8y (more details), 1.45 Å
SCOPe Domain Sequences for d2a8yd_:
Sequence, based on SEQRES records: (download)
>d2a8yd_ c.56.2.1 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mieqnekasigiiggsglydpgifseskeikvytpygqpsdfitigkignksvaflprhg rghripphkinyraniwalkelgvrwvisvsavgslrmdyklgdfvipdqfidmtknrey sffdgpvvahvsmadpfcnslrklaietakelnikthesgtyiciegprfstraesrtwr evykadiigmtlvpevnlaceaqmcyatiamvtdydvfaeipvtaeevtrvmaentekak kllyaliqklpekpeegscsccnslktalv
>d2a8yd_ c.56.2.1 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mieqnekasigiiggsglydpgifseskeikvytpygqpsdfitigkignksvaflprhg rghripphkinyraniwalkelgvrwvisvsavgslrmdyklgdfvipdqfidmtknrey sffdgpvvahvsmadpfcnslrklaietakelnikthesgtyiciegprfstraesrtwr evykadiigmtlvpevnlaceaqmcyatiamvtdydvfaeipvtaeevtrvmaentekak kllyaliqklpekpcnslktalv
Timeline for d2a8yd_: