Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily) beta(3)-alpha(5); meander beta-sheet packed against array of helices |
Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) |
Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins) automatically mapped to Pfam PF04358 |
Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (4 species) |
Species Archaeoglobus fulgidus [TaxId:224325] [187377] (2 PDB entries) |
Domain d2a5wc_: 2a5w C: [162698] automated match to d1ji8a_ complexed with so4 |
PDB Entry: 2a5w (more details), 2.1 Å
SCOPe Domain Sequences for d2a5wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a5wc_ d.203.1.1 (C:) DsrC, the gamma subunit of dissimilatory sulfite reductase {Archaeoglobus fulgidus [TaxId: 224325]} pelevkgkklrldedgflqdweewdeevaealakdtrfspqpielteehwkiirylrdyf ikygvappvrmlvkhckkevrpdcnlqyiyklfpqgpakdacriaglpkptgcv
Timeline for d2a5wc_: