Lineage for d2a5wc_ (2a5w C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050586Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily)
    beta(3)-alpha(5); meander beta-sheet packed against array of helices
  4. 1050587Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) (S)
  5. 1050588Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins)
  6. 1050589Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (3 species)
  7. 1050590Species Archaeoglobus fulgidus [TaxId:224325] [187377] (2 PDB entries)
  8. 1050594Domain d2a5wc_: 2a5w C: [162698]
    automated match to d1ji8a_
    complexed with so4

Details for d2a5wc_

PDB Entry: 2a5w (more details), 2.1 Å

PDB Description: Crystal structure of the oxidized gamma-subunit of the dissimilatory sulfite reductase (DsrC) from Archaeoglobus fulgidus
PDB Compounds: (C:) sulfite reductase, desulfoviridin-type subunit gamma (dsvC)

SCOPe Domain Sequences for d2a5wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5wc_ d.203.1.1 (C:) DsrC, the gamma subunit of dissimilatory sulfite reductase {Archaeoglobus fulgidus [TaxId: 224325]}
pelevkgkklrldedgflqdweewdeevaealakdtrfspqpielteehwkiirylrdyf
ikygvappvrmlvkhckkevrpdcnlqyiyklfpqgpakdacriaglpkptgcv

SCOPe Domain Coordinates for d2a5wc_:

Click to download the PDB-style file with coordinates for d2a5wc_.
(The format of our PDB-style files is described here.)

Timeline for d2a5wc_: