Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
Protein Scorpion toxin [57097] (17 species) |
Species Chinese scorpion (Buthus martensii), toxin m1 [TaxId:34649] [57106] (11 PDB entries) Uniprot P45697 |
Domain d1zuta1: 1zut A:3-66 [162599] Other proteins in same PDB: d1zuta2 automated match to d1t7aa_ complexed with so4; mutant |
PDB Entry: 1zut (more details), 1.7 Å
SCOPe Domain Sequences for d1zuta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zuta1 g.3.7.1 (A:3-66) Scorpion toxin {Chinese scorpion (Buthus martensii), toxin m1 [TaxId: 34649]} vrdayiadshncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpikvp gkch
Timeline for d1zuta1: