SCOPe 2.08: Domain d1zuta1: 1zut A:3-66

Lineage for d1zuta1 (1zut A:3-66)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)

6. Protein Scorpion toxin [57097] (17 species)

7. Species Chinese scorpion (Buthus martensii), toxin m1 [TaxId:34649] [57106] (11 PDB entries)
   Uniprot P45697

8. Domain d1zuta1: 1zut A:3-66 [162599]
   Other proteins in same PDB: d1zuta2
   automated match to d1t7aa_
   complexed with so4; mutant

Details for d1zuta1

PDB Entry: 1zut, 1.7 Å

PDB Description: crystal structure of mutant k8dp9sr58k of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch

PDB Compounds: (A:) Alpha-like neurotoxin BmK-I

SCOPe Domain Sequences for d1zuta1:

Sequence; same for both SEQRES and ATOM records:

>d1zuta1 g.3.7.1 (A:3-66) Scorpion toxin {Chinese scorpion (Buthus martensii), toxin m1 [TaxId: 34649]}
vrdayiadshncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpikvp
gkch

Timeline for d1zuta1:

• d1zuta1 first appeared in SCOPe 2.01, called d1zuta_
  
• d1zuta1 appears in SCOPe 2.07