SCOPe 2.04: Domain d1zgoa_: 1zgo A:

Lineage for d1zgoa_ (1zgo A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Coral (Discosoma sp.) [TaxId:86600] [188539] (17 PDB entries)

8. Domain d1zgoa_: 1zgo A: [162456]
   automated match to d1g7ka_

Details for d1zgoa_

PDB Entry: 1zgo, 1.4 Å

PDB Description: High Resolution Crystal Structure of the Discosoma Red Fluorescent Protein (DsRed)

PDB Compounds: (A:) red fluorescent protein drfp583

SCOPe Domain Sequences for d1zgoa_:

Sequence; same for both SEQRES and ATOM records:

>d1zgoa_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf
qygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfi
gvnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakk
pvqlpgyyyvdsklditshnedytiveqyertegrhhlfl

Timeline for d1zgoa_:

• d1zgoa_ first appeared in SCOPe 2.01
  
• d1zgoa_ appears in SCOPe 2.03
  
• d1zgoa_ appears in SCOPe 2.05
  
• d1zgoa_ appears in the current release, SCOPe 2.08