Lineage for d1zdra_ (1zdr A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1872191Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1872192Protein automated matches [190777] (19 species)
    not a true protein
  7. 1872352Species Geobacillus stearothermophilus [TaxId:1422] [188185] (1 PDB entry)
  8. 1872353Domain d1zdra_: 1zdr A: [162449]
    automated match to d1ddra_
    complexed with gol, so4

Details for d1zdra_

PDB Entry: 1zdr (more details), 2 Å

PDB Description: DHFR from Bacillus Stearothermophilus
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1zdra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdra_ c.71.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mishivamdenrvigkdnrlpwhlpadlayfkrvtmghaivmgrktfeaigrplpgrdnv
vvtgnrsfrpegclvlhsleevkqwiasradevfiiggaelfratmpivdrlyvtkifas
fpgdtfyppisddeweivsytpggkdeknpyehafiiyerk

SCOPe Domain Coordinates for d1zdra_:

Click to download the PDB-style file with coordinates for d1zdra_.
(The format of our PDB-style files is described here.)

Timeline for d1zdra_: