| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (28 species) not a true protein |
| Species Geobacillus stearothermophilus [TaxId:1422] [188185] (1 PDB entry) |
| Domain d1zdra_: 1zdr A: [162449] automated match to d1ddra_ complexed with gol, so4 |
PDB Entry: 1zdr (more details), 2 Å
SCOPe Domain Sequences for d1zdra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zdra_ c.71.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mishivamdenrvigkdnrlpwhlpadlayfkrvtmghaivmgrktfeaigrplpgrdnv
vvtgnrsfrpegclvlhsleevkqwiasradevfiiggaelfratmpivdrlyvtkifas
fpgdtfyppisddeweivsytpggkdeknpyehafiiyerk
Timeline for d1zdra_: