SCOPe 2.06: Domain d1zdra_: 1zdr A:

Lineage for d1zdra_ (1zdr A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188185] (1 PDB entry)

8. Domain d1zdra_: 1zdr A: [162449]
   automated match to d1ddra_
   complexed with gol, so4

Details for d1zdra_

PDB Entry: 1zdr, 2 Å

PDB Description: DHFR from Bacillus Stearothermophilus

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1zdra_:

Sequence; same for both SEQRES and ATOM records:

>d1zdra_ c.71.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mishivamdenrvigkdnrlpwhlpadlayfkrvtmghaivmgrktfeaigrplpgrdnv
vvtgnrsfrpegclvlhsleevkqwiasradevfiiggaelfratmpivdrlyvtkifas
fpgdtfyppisddeweivsytpggkdeknpyehafiiyerk

Timeline for d1zdra_:

• d1zdra_ first appeared in SCOPe 2.01
  
• d1zdra_ appears in SCOPe 2.05
  
• d1zdra_ appears in SCOPe 2.07
  
• d1zdra_ appears in the current release, SCOPe 2.08