SCOPe 2.01: Domain d1zc2b_: 1zc2 B:

Lineage for d1zc2b_ (1zc2 B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (13 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [188184] (2 PDB entries)

8. Domain d1zc2b_: 1zc2 B: [162441]
   automated match to d1fr1a_
   complexed with cit

Details for d1zc2b_

PDB Entry: 1zc2, 2.09 Å

PDB Description: Crystal Structure of plasmid-encoded class C beta-lactamase CMY-2 complexed with citrate molecule

PDB Compounds: (B:) beta-lactamase class C

SCOPe Domain Sequences for d1zc2b_:

Sequence; same for both SEQRES and ATOM records:

>d1zc2b_ e.3.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
qqiadivnrtitplmqeqaipgmavaviyqgkpyyftwgkadiannhpvtqqtlfelgsv
sktfngvlggdaiargeiklsdpvtkywpeltgkqwqgirllhlatytagglplqipddv
rdkaallhfyqnwqpqwtpgakrlyanssiglfgalavkpsgmsyeeamtrrvlqplkla
htwitvpqneqkdyawgyregkpvhvspgqldaeaygvkssvidmarwvqanmdashvqe
ktlqqgialaqsrywrigdmyqglgwemlnwplkadsiingsdskvalaalpavevnppa
pavkaswvhktgstggfgsyvafvpeknlgivmlanksypnpvrveaawrileklq

Timeline for d1zc2b_:

• d1zc2b_ is new in SCOPe 2.01-stable
  
• d1zc2b_ appears in SCOPe 2.02
  
• d1zc2b_ appears in the current release, SCOPe 2.08