Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins) |
Protein automated matches [190852] (1 species) not a true protein |
Species Cowpea chlorotic mottle virus [TaxId:12303] [188176] (1 PDB entry) |
Domain d1za7c_: 1za7 C: [162430] automated match to d1cwpb_ |
PDB Entry: 1za7 (more details), 2.7 Å
SCOPe Domain Sequences for d1za7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za7c_ b.121.4.5 (C:) automated matches {Cowpea chlorotic mottle virus [TaxId: 12303]} rvvqpvivepiasgqgraikawtgysvskwtascaaaeakvtsaitislpnelssernkq lkvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgi tleqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy
Timeline for d1za7c_: