SCOPe 2.06: Domain d1za7c_: 1za7 C:

Lineage for d1za7c_ (1za7 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)

6. Protein automated matches [190852] (1 species)
   not a true protein

7. Species Cowpea chlorotic mottle virus [TaxId:12303] [188176] (1 PDB entry)

8. Domain d1za7c_: 1za7 C: [162430]
   automated match to d1cwpb_

Details for d1za7c_

PDB Entry: 1za7, 2.7 Å

PDB Description: the crystal structure of salt stable cowpea cholorotic mottle virus at 2.7 angstroms resolution.

PDB Compounds: (C:) coat protein

SCOPe Domain Sequences for d1za7c_:

Sequence; same for both SEQRES and ATOM records:

>d1za7c_ b.121.4.5 (C:) automated matches {Cowpea chlorotic mottle virus [TaxId: 12303]}
rvvqpvivepiasgqgraikawtgysvskwtascaaaeakvtsaitislpnelssernkq
lkvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgi
tleqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy

Timeline for d1za7c_:

• d1za7c_ first appeared in SCOPe 2.01
  
• d1za7c_ appears in SCOPe 2.05
  
• d1za7c_ appears in SCOPe 2.07
  
• d1za7c_ appears in the current release, SCOPe 2.08