Lineage for d1z9ad_ (1z9a D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829505Protein Xylose reductase [75058] (1 species)
  7. 2829506Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries)
    Uniprot O74237
  8. 2829536Domain d1z9ad_: 1z9a D: [162422]
    automated match to d1jeza_
    complexed with nad; mutant

Details for d1z9ad_

PDB Entry: 1z9a (more details), 2.4 Å

PDB Description: crystal structure of the asn-309 to asp mutant of candida tenuis xylose reductase (akr2b5) bound to nad+
PDB Compounds: (D:) NAD(P)H-dependent D-xylose reductase

SCOPe Domain Sequences for d1z9ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9ad_ c.1.7.1 (D:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
diglrfddpwdwdnipifv

SCOPe Domain Coordinates for d1z9ad_:

Click to download the PDB-style file with coordinates for d1z9ad_.
(The format of our PDB-style files is described here.)

Timeline for d1z9ad_: