PDB entry 1z9a

View 1z9a on RCSB PDB site
Description: Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2B5) Bound To Nad+
Class: oxidoreductase
Keywords: beta-alpha-barrel, AKR, aldo-keto reductase, xylose reductase, candida tenuis, substrate selectivity, ketone reduction, structure-activity correlation, OXIDOREDUCTASE
Deposited on 2005-04-01, released 2006-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYL1, XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-320)
      • engineered (308)
    Domains in SCOPe 2.07: d1z9aa_
  • Chain 'B':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYL1, XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-320)
      • engineered (308)
    Domains in SCOPe 2.07: d1z9ab_
  • Chain 'C':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYL1, XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-320)
      • engineered (308)
    Domains in SCOPe 2.07: d1z9ac_
  • Chain 'D':
    Compound: NAD(P)H-dependent D-xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYL1, XYLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74237 (Start-320)
      • engineered (308)
    Domains in SCOPe 2.07: d1z9ad_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z9aA (A:)
    sasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdg
    vkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkf
    vpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllr
    gatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfa
    hdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeia
    kldiglrfddpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9aA (A:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfddpwdwdnipifv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z9aB (B:)
    sasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdg
    vkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkf
    vpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllr
    gatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfa
    hdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeia
    kldiglrfddpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9aB (B:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfddpwdwdnipifv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z9aC (C:)
    sasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdg
    vkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkf
    vpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllr
    gatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfa
    hdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeia
    kldiglrfddpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9aC (C:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfddpwdwdnipifv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z9aD (D:)
    sasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdg
    vkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkf
    vpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllr
    gatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfa
    hdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeia
    kldiglrfddpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z9aD (D:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
    tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
    diglrfddpwdwdnipifv