Lineage for d1z5na_ (1z5n A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1608160Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1608177Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1608178Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1608236Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species)
  7. 1608237Species Escherichia coli [TaxId:562] [82449] (8 PDB entries)
  8. 1608247Domain d1z5na_: 1z5n A: [162386]
    automated match to d1nc3a_
    complexed with ade, sr1; mutant

Details for d1z5na_

PDB Entry: 1z5n (more details), 2.1 Å

PDB Description: crystal structure of mta/adohcy nucleosidase glu12gln mutant complexed with 5-methylthioribose and adenine
PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d1z5na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5na_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]}
fsmkigiigameeqvtllrdkienrqtislggceiytgqlngtevallksgigkvaaalg
atlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpag
fkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeatai
ahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg

SCOPe Domain Coordinates for d1z5na_:

Click to download the PDB-style file with coordinates for d1z5na_.
(The format of our PDB-style files is described here.)

Timeline for d1z5na_: