SCOPe 2.08: Domain d1z5na1: 1z5n A:1-232

Lineage for d1z5na1 (1z5n A:1-232)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species)

7. Species Escherichia coli [TaxId:562] [82449] (8 PDB entries)

8. Domain d1z5na1: 1z5n A:1-232 [162386]
   Other proteins in same PDB: d1z5na2
   automated match to d1nc3a_
   complexed with ade, sr1; mutant

Details for d1z5na1

PDB Entry: 1z5n, 2.1 Å

PDB Description: crystal structure of mta/adohcy nucleosidase glu12gln mutant complexed with 5-methylthioribose and adenine

PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d1z5na1:

Sequence; same for both SEQRES and ATOM records:

>d1z5na1 c.56.2.1 (A:1-232) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]}
mkigiigameeqvtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg

Timeline for d1z5na1:

• d1z5na1 first appeared in SCOPe 2.01, called d1z5na_
  
• d1z5na1 appears in SCOPe 2.07