Lineage for d1z17a_ (1z17 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913163Protein automated matches [190296] (11 species)
    not a true protein
  7. 2913168Species Escherichia coli K-12 [TaxId:83333] [187775] (6 PDB entries)
  8. 2913171Domain d1z17a_: 1z17 A: [162352]
    automated match to d2liva_
    complexed with ile, mrd

Details for d1z17a_

PDB Entry: 1z17 (more details), 1.96 Å

PDB Description: Crystal structure analysis of periplasmic Leu/Ile/Val-binding protein with bound ligand isoleucine
PDB Compounds: (A:) Leu/Ile/Val-binding protein

SCOPe Domain Sequences for d1z17a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z17a_ c.93.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqivkyddacdpkqava
vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak

SCOPe Domain Coordinates for d1z17a_:

Click to download the PDB-style file with coordinates for d1z17a_.
(The format of our PDB-style files is described here.)

Timeline for d1z17a_: