![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins) |
![]() | Protein automated matches [190296] (4 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [187775] (5 PDB entries) |
![]() | Domain d1z17a_: 1z17 A: [162352] automated match to d2liva_ complexed with ile, mrd |
PDB Entry: 1z17 (more details), 1.96 Å
SCOPe Domain Sequences for d1z17a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z17a_ c.93.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqivkyddacdpkqava vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak
Timeline for d1z17a_: