Lineage for d1odda_ (1odd A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1080708Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1080709Family a.4.6.1: PhoB-like [46895] (5 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 1080710Protein OmpR [46896] (1 species)
  7. 1080711Species Escherichia coli [TaxId:562] [46897] (3 PDB entries)
  8. 1080713Domain d1odda_: 1odd A: [16232]

Details for d1odda_

PDB Entry: 1odd (more details), 2.2 Å

PDB Description: ompr c-terminal domain (ompr-c) from escherichia coli
PDB Compounds: (A:) Transcriptional regulatory protein ompR

SCOPe Domain Sequences for d1odda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odda_ a.4.6.1 (A:) OmpR {Escherichia coli [TaxId: 562]}
aviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreys
amersidvqisrlrrmveedpahpryiqtvwglgyvfvpd

SCOPe Domain Coordinates for d1odda_:

Click to download the PDB-style file with coordinates for d1odda_.
(The format of our PDB-style files is described here.)

Timeline for d1odda_: