Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) |
Family c.70.1.0: automated matches [191403] (1 protein) not a true family |
Protein automated matches [190539] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [188145] (1 PDB entry) |
Domain d1yoea_: 1yoe A: [162274] automated match to d1q8fa_ complexed with ca, rib |
PDB Entry: 1yoe (more details), 1.78 Å
SCOPe Domain Sequences for d1yoea_:
Sequence, based on SEQRES records: (download)
>d1yoea_ c.70.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} gsalpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnvlrmltllnrt dipvaggavkplmreliiadnvhgesgldgpalpeptfapqnctavelmaktlresaepv tivstgpqtnvalllnshpelhskiarivimggamglgnwtpaaefniyvdpeaaeivfq sgipvvmagldvthkaqihvedterfraignpvstivaelldffleyhkdekwgfvgapl hdpctiawllkpelftsverwvgvetqgkytqgmtvvdyyyltgnkpnatvmvdvdrqgf vdlladrlkfya
>d1yoea_ c.70.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} gsalpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnvlrmltllnrt dipvaggavkplmreliiaesgldgpalpeptfapqnctavelmaktlresaepvtivst gpqtnvalllnshpelhskiarivimggamglgnwtpaaefniyvdpeaaeivfqsgipv vmagldvthkaqihvedterfraignpvstivaelldfflekwgfvgaplhdpctiawll kpelftsverwvgvetqgkytqgmtvvdyyyltgnkpnatvmvdvdrqgfvdlladrlkf ya
Timeline for d1yoea_: