Lineage for d1yoea1 (1yoe A:2-311)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136800Family c.70.1.0: automated matches [191403] (1 protein)
    not a true family
  6. 2136801Protein automated matches [190539] (5 species)
    not a true protein
  7. 2136814Species Escherichia coli [TaxId:562] [188145] (1 PDB entry)
  8. 2136815Domain d1yoea1: 1yoe A:2-311 [162274]
    Other proteins in same PDB: d1yoea2
    automated match to d1q8fa_
    complexed with ca, rib

Details for d1yoea1

PDB Entry: 1yoe (more details), 1.78 Å

PDB Description: Crystal structure of a the E. coli pyrimidine nucleoside hydrolase YbeK with bound ribose
PDB Compounds: (A:) Hypothetical protein ybeK

SCOPe Domain Sequences for d1yoea1:

Sequence, based on SEQRES records: (download)

>d1yoea1 c.70.1.0 (A:2-311) automated matches {Escherichia coli [TaxId: 562]}
alpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnvlrmltllnrtdi
pvaggavkplmreliiadnvhgesgldgpalpeptfapqnctavelmaktlresaepvti
vstgpqtnvalllnshpelhskiarivimggamglgnwtpaaefniyvdpeaaeivfqsg
ipvvmagldvthkaqihvedterfraignpvstivaelldffleyhkdekwgfvgaplhd
pctiawllkpelftsverwvgvetqgkytqgmtvvdyyyltgnkpnatvmvdvdrqgfvd
lladrlkfya

Sequence, based on observed residues (ATOM records): (download)

>d1yoea1 c.70.1.0 (A:2-311) automated matches {Escherichia coli [TaxId: 562]}
alpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnvlrmltllnrtdi
pvaggavkplmreliiaesgldgpalpeptfapqnctavelmaktlresaepvtivstgp
qtnvalllnshpelhskiarivimggamglgnwtpaaefniyvdpeaaeivfqsgipvvm
agldvthkaqihvedterfraignpvstivaelldfflekwgfvgaplhdpctiawllkp
elftsverwvgvetqgkytqgmtvvdyyyltgnkpnatvmvdvdrqgfvdlladrlkfya

SCOPe Domain Coordinates for d1yoea1:

Click to download the PDB-style file with coordinates for d1yoea1.
(The format of our PDB-style files is described here.)

Timeline for d1yoea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yoea2