Lineage for d1boaa1 (1boa A:375-448)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307096Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. 2307097Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 2307098Species Human (Homo sapiens) [TaxId:9606] [46890] (18 PDB entries)
    Uniprot P50579 110-478
  8. 2307104Domain d1boaa1: 1boa A:375-448 [16226]
    Other proteins in same PDB: d1boaa2
    complexed with co, fug

Details for d1boaa1

PDB Entry: 1boa (more details), 1.8 Å

PDB Description: human methionine aminopeptidase 2 complexed with angiogenesis inhibitor fumagillin
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1boaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1boaa1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

SCOPe Domain Coordinates for d1boaa1:

Click to download the PDB-style file with coordinates for d1boaa1.
(The format of our PDB-style files is described here.)

Timeline for d1boaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1boaa2